The domain within your query sequence starts at position 4 and ends at position 182; the E-value for the PMP22_Claudin domain shown below is 2.9e-32.

YALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANIRMQ
CKVYDSLLALSPDLQASRGLMCAASVLAFLAFMTAILGMKCTRCTGDDENVKSRILLTAG
IIFFITGLVVLIPVSWVANSIIRDFYNPLVDVALKRELGEALYIGWTTALVLIAGGALF

PMP22_Claudin

PMP22_Claudin
PFAM accession number:PF00822
Interpro abstract (IPR004031): This family of evolutionarily related integral membrane proteins includes PMP22, EMP, claudins and voltage-gated calcium channel gamma subunits, many of which which perform diverse functions at specialised cell-cell contacts [(PUBMED:24665403)]. Family members from vertebrates and invertebrates are highly divergent.
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMP22_Claudin