The domain within your query sequence starts at position 7 and ends at position 196; the E-value for the PMP22_Claudin domain shown below is 4.4e-22.
RALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAG REKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQ RTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSF LLKEGAGVMS
PMP22_Claudin |
---|
PFAM accession number: | PF00822 |
---|---|
Interpro abstract (IPR004031): | This family of evolutionarily related integral membrane proteins includes PMP22, EMP, claudins and voltage-gated calcium channel gamma subunits, many of which which perform diverse functions at specialised cell-cell contacts [ (PUBMED:24665403) ]. Family members from vertebrates and invertebrates are highly divergent. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMP22_Claudin