The domain within your query sequence starts at position 121 and ends at position 184; the E-value for the PMSI1 domain shown below is 1.2e-26.
DTRKTTNGPSSTTSLVPVHLRRRPILPPTSPSPSPALAFWKRVRIGLEDIWNSLSSVFTE TQPV
PMSI1 |
![]() |
---|
PFAM accession number: | PF15322 |
---|---|
Interpro abstract (IPR029292): | This entry represents protein MENT (methylated in normal thymocytes protein), which is involved in control of cellular proliferation. It is an onconcogenic modifier contributing to the tumour suppressor function of DNMT3B (DNA methyltransferase 3B) [(PUBMED:22133874)]. This entry also includes the mouse Pmis1 protein that may regulate sperm transport into the oviducts and function in modulating sperm-zona binding [(PUBMED:22621904)]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PMSI1