SMART: Pfam domain PNISR

The domain within your query sequence starts at position 223 and ends at position 391; the E-value for the PNISR domain shown below is 1.1e-55.

QIDAVKRRTLPAWIREGLEKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPRL
PQRSKFDSDEEDEDAENLEAVSSGKVTRSPSPAPQEEHSEPEMTEEEKEYQMMLLTKMLL
TEILLDVTDEEIYYVAKDAHRKATKAPAKQLAQSSALASLTGLGGLGGY

PNISR

PFAM accession number:	PF15996
Interpro abstract (IPR031937):	Pinin (PNN) has been identified as central in the establishment and maintenance of corneal epithelial cell-cell adhesion. Three SR-rich proteins have been identified that interact with the C terminus of PNN; one of them is this 130kDa nuclear protein, SRrp130, also known as PNISR [ (PUBMED:14578391) ]. SRrp130 is a protein of 805 amino acid residues with multiple arginine-serine (RS) repeats but had no RNA recognition motif [ (PUBMED:14578391) ]. Its function is unknown.

PFAM accession number:

PF15996

Interpro abstract (IPR031937):

Pinin (PNN) has been identified as central in the establishment and maintenance of corneal epithelial cell-cell adhesion. Three SR-rich proteins have been identified that interact with the C terminus of PNN; one of them is this 130kDa nuclear protein, SRrp130, also known as PNISR [ (PUBMED:14578391) ]. SRrp130 is a protein of 805 amino acid residues with multiple arginine-serine (RS) repeats but had no RNA recognition motif [ (PUBMED:14578391) ]. Its function is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PNISR