The domain within your query sequence starts at position 211 and ends at position 291; the E-value for the PNK3P domain shown below is 5.3e-27.
KVLVATHAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFS CADRLFALNVGLPFATPEEFF
PNK3P |
![]() |
---|
PFAM accession number: | PF08645 |
---|---|
Interpro abstract (IPR013954): | Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [ (PUBMED:11729194) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PNK3P