The domain within your query sequence starts at position 211 and ends at position 291; the E-value for the PNK3P domain shown below is 5.3e-27.

KVLVATHAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFS
CADRLFALNVGLPFATPEEFF

PNK3P

• PFAM accession number: PF08645
• Interpro abstract (IPR013954):

  Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [ (PUBMED:11729194) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PNK3P