The domain within your query sequence starts at position 1 and ends at position 326; the E-value for the PNMA domain shown below is 6e-143.

MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDETEIEETLQAAMPQVSYRVLGRMFWREEN
AKAALLELTGAVDYSLIPREMPGKGGLWKVVFKPPTSDAVFLERLHLFLAREGWTVQDVA
RVLGFQNPAPAPGPEMPAEMLNYILDNVIQPLVESIWYKKLTLFSGKDIPGPGEETFDSW
LEHSNEIIEEWQVSDIEKRRRLMESLRGPAADVIRILKTNNAAITTAECLKALEQVFGSV
ESSRDAQVRFLNTYQNPGEKLSSYVIRLEPLLQKVVDKGVIDKDNVNQARLEQVIAGANH
SGALRRQLWLAGAEEGPAPNLFQLLV

PNMA

PNMA
PFAM accession number:PF14893
Interpro abstract (IPR026523): The paraneoplastic Ma antigens (PNMA) have been identified using sera from patients with paraneoplastic neurological syndromes [(PUBMED:16214224)]. This family includes paraneoplastic antigen PNMA1 [(PUBMED:10050892)], PNMA2 [(PUBMED:10362822)], PNMA3 [(PUBMED:11558790)], PNMA4 (also known as modulator of apoptosis 1 or MOAP-1) [(PUBMED:11060313)] and some paraneoplastic antigen-like proteins (PNMA5 and PNMA6). The family also includes modulator of apoptosis 1, which has a role in death receptor-dependent apoptosis [(PUBMED:15949439)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PNMA