The domain within your query sequence starts at position 152 and ends at position 299; the E-value for the POT1PC domain shown below is 6.7e-41.

QLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHIE
RLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGT
SYGRGIRVLPDTSPCVDQLKKALEGANL

POT1PC

POT1PC
PFAM accession number:PF16686
Interpro abstract (IPR032042):

This entry represents the ssDNA-binding domain found in telomere protection protein 1 (Pot1). This domain is able to accommodate heterogeneous ssDNA ligands. Pot1 is responsible for binding to and protecting the 3' single-stranded DNA (ssDNA) overhang at most eukaryotic telomeres [(PUBMED:23201273)].

GO function:single-stranded telomeric DNA binding (GO:0043047)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry POT1PC