The domain within your query sequence starts at position 462 and ends at position 519; the E-value for the PP1_bind domain shown below is 2.8e-20.

KRRRVSFGGHLRPELFDENLPPNTPLKRGETPTKRKSLGTHSPAVLKTIIKERPQSPG

PP1_bind

PP1_bind
PFAM accession number:PF15276
Interpro abstract (IPR029334):

This domain contains a protein phosphatase 1 (PP1) binding site [(PUBMED:16492807)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PP1_bind