The domain within your query sequence starts at position 462 and ends at position 519; the E-value for the PP1_bind domain shown below is 2.8e-20.
KRRRVSFGGHLRPELFDENLPPNTPLKRGETPTKRKSLGTHSPAVLKTIIKERPQSPG
PP1_bind |
---|
PFAM accession number: | PF15276 |
---|---|
Interpro abstract (IPR029334): | This domain contains a protein phosphatase 1 (PP1) binding site [ (PUBMED:16492807) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PP1_bind