The domain within your query sequence starts at position 1 and ends at position 78; the E-value for the PPARgamma_N domain shown below is 7.3e-34.

MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMV
ADYKYDLKLQEYQSAIKV

PPARgamma_N

PPARgamma_N
PFAM accession number:PF12577
Interpro abstract (IPR022590):

This domain is found in eukaryotes, and is typically between 42 and 65 amino acids in length. It is found N-terminal to and. There are two completely conserved residues (D and Y) that may be functionally important. Peroxisome proliferator-activated receptors (PPAR) are nuclear hormone receptors that control the expression of genes involved in lipid homeostasis in mammals[(PUBMED:15726823)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPARgamma_N