The domain within your query sequence starts at position 1 and ends at position 111; the E-value for the PPDFL domain shown below is 4.2e-55.
MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPGLPKADPGHWWASFFF GKSTLPFMTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNP
PPDFL |
---|
PFAM accession number: | PF15060 |
---|---|
Interpro abstract (IPR026754): | Proteins in this family are probable regulators of exocrine pancreas development [ (PUBMED:19067490) ]. |
GO process: | cell differentiation (GO:0030154), multicellular organism development (GO:0007275) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPDFL