The domain within your query sequence starts at position 22 and ends at position 87; the E-value for the PPI_Ypi1 domain shown below is 8.7e-26.
VTETTEPENQSLTMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTE SDEDEE
PPI_Ypi1 |
---|
PFAM accession number: | PF07491 |
---|---|
Interpro abstract (IPR011107): | This family includes Saccharomyces cerevisiae type 1 protein phosphatase inhibitor Ypi1 [ (PUBMED:14506263) ] and human protein phosphatase 1 regulatory subunit 11 (Ppp1r11/hcgv), an atypical E3 ubiquitin-protein ligase also known to be a PP1 inhibitor [ (PUBMED:9843442) (PUBMED:27805901) ]. |
GO process: | negative regulation of phosphoprotein phosphatase activity (GO:0032515) |
GO function: | protein serine/threonine phosphatase inhibitor activity (GO:0004865) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPI_Ypi1