The domain within your query sequence starts at position 5 and ends at position 77; the E-value for the PPI_Ypi1 domain shown below is 2e-24.

RVKAEEMRKQENKENQSLTMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCCCIYEKPRAF
GESSTESDEDEEE

PPI_Ypi1

PPI_Ypi1
PFAM accession number:PF07491
Interpro abstract (IPR011107):

This family includes Saccharomyces cerevisiae type 1 protein phosphatase inhibitor Ypi1 [(PUBMED:14506263)] and human protein phosphatase 1 regulatory subunit 11 (Ppp1r11/hcgv), an atypical E3 ubiquitin-protein ligase also known to be a PP1 inhibitor [(PUBMED:9843442), (PUBMED:27805901)].

GO process:negative regulation of phosphoprotein phosphatase activity (GO:0032515)
GO function:protein serine/threonine phosphatase inhibitor activity (GO:0004865)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPI_Ypi1