The domain within your query sequence starts at position 107 and ends at position 255; the E-value for the PPP1R35_C domain shown below is 1.5e-48.
PALQSSLALSLELQNARAAVASGQFDASKAVEEQLRKSFRTRCALEETVAEGLNVPRSKR LYRDLVSLQVPEEQVLNAALREKLAMLPPQPRAPPLKEVLGPGPDMTMLCNPDSLWSESP HLTVDGLPPLRLQARPRPSEDTFLMHRML
PPP1R35_C |
---|
PFAM accession number: | PF15503 |
---|---|
Interpro abstract (IPR029135): | This entry represents the C terminus of protein phosphatase 1 regulatory subunit 35. This protein inhibits the serine/threonine-protein phosphatase PPP1CA [ (PUBMED:19389623) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPP1R35_C