The domain within your query sequence starts at position 48 and ends at position 144; the E-value for the PPP1R35_C domain shown below is 2.5e-32.

PALQSSLALSLELQNARAAVASGQFDASKAVEEQLRKSFRTRCALEETVAEGLNVPRSKR
LYRDLVSLQVPEEQVLNAALREKLAMLPPQPRAPPLK

PPP1R35_C

PPP1R35_C
PFAM accession number:PF15503
Interpro abstract (IPR029135):

This entry represents the C terminus of protein phosphatase 1 regulatory subunit 35. This protein inhibits the serine/threonine-protein phosphatase PPP1CA [(PUBMED:19389623)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPP1R35_C