The domain within your query sequence starts at position 6 and ends at position 313; the E-value for the PPP4R2 domain shown below is 9.1e-80.
LQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAP EPRGPPNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGV EKNVMVVSCVCPSSEKNNSNSLNRMNGVMFPGNSPNYTDRSNINGPGTPRPLNRPKLSLS APLTTNGLPESTDSKDSELQLSEEKGHSDSSASESEVSLLSPVKNKHPDEDAVESEEHEV KRLKFDKEGDVRETASQTVSGEVSSVRAEETETAAPPPDKDRESRTRQHCTEEEEEEEEE EEEEEEES
PPP4R2 |
---|
PFAM accession number: | PF09184 |
---|---|
Interpro abstract (IPR015267): | Protein phosphatase 4 core regulatory subunit R2 (PPP4R2), also known as Psy4 in budding yeast, is the regulatory subunit of the histone H2A phosphatase complex. The histone H2A phosphatase complex dephosphorylates H2AS128ph (gamma-H2A) that has been displaced from sites of DNA lesions in the double-stranded DNA break repair process. Dephosphorylation of Psy4 is necessary for efficient recovery from the DNA damage checkpoint [ (PUBMED:16299494) ]. |
GO component: | protein phosphatase 4 complex (GO:0030289) |
GO function: | protein phosphatase regulator activity (GO:0019888) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPP4R2