The domain within your query sequence starts at position 52 and ends at position 402; the E-value for the PPPI_inhib domain shown below is 5.7e-109.

FTPAIELKEKGKKGKAVHFAEMDSGASERLTDKRFASRDEKAAKALEKRSQQGNVTLDDV
KFVALLSLQDTEMQRICSFTTFLRNKNLDSFLMALLYYLSYYLQRLSMEKNPQSRVVGLI
EKKEVELVVNKLEDAQKYLAQKYCILVLGLGMADKHHLSCGKEKISDTQKDWKFFESFYT
FCTCIAWIVFRRQYLTEIEEEVGRLFRTNMFNIPRRKHEDEASGGEKKRMTLVQFRRMMA
KRPAIKKAVDMRSPVLSTLLPSLREKAQHITEKKYVAGIKLQPREENIITDLESVAMPIV
GILGEPRNLFNPNTLLPLELEENTKPSGRSSSIVETNNTKIQNTLSLVMSK

PPPI_inhib

PPPI_inhib
PFAM accession number:PF14895
Interpro abstract (IPR026142): Members of this protein family inhibit phosphatase activity of protein phosphatase 1 (PP1) complexes [(PUBMED:19389623)].
GO process:negative regulation of phosphatase activity (GO:0010923)
GO function:phosphatase binding (GO:0019902)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPPI_inhib