SMART: Pfam domain PQ-loop

The domain within your query sequence starts at position 17 and ends at position 77; the E-value for the PQ-loop domain shown below is 2e-14.

VSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESP
L

PQ-loop

PFAM accession number:	PF04193
Interpro abstract (IPR006603):	Some membrane bound proteins possess a pair of repeats each spanning two transmembrane helices connected by a loop [ (PUBMED:11731489) ]. The PQ motif found on loop 2 is critical for the localisation of cystinosin to lysosomes [ (PUBMED:11150305) ]. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought to possess a more general function; most probably this involves a glutamine residue [ (PUBMED:11731489) ].

PFAM accession number:

PF04193

Interpro abstract (IPR006603):

Some membrane bound proteins possess a pair of repeats each spanning two transmembrane helices connected by a loop [ (PUBMED:11731489) ]. The PQ motif found on loop 2 is critical for the localisation of cystinosin to lysosomes [ (PUBMED:11150305) ]. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought to possess a more general function; most probably this involves a glutamine residue [ (PUBMED:11731489) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PQ-loop