The domain within your query sequence starts at position 17 and ends at position 77; the E-value for the PQ-loop domain shown below is 3.2e-14.

VSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVANILRILFWFGRHFESP
L

PQ-loop

PQ-loop
PFAM accession number:PF04193
Interpro abstract (IPR006603):

Some membrane bound proteins possess a pair of repeats each spanning two transmembrane helices connected by a loop [(PUBMED:11731489)]. The PQ motif found on loop 2 is critical for the localisation of cystinosin to lysosomes [(PUBMED:11150305)]. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought to possess a more general function; most probably this involves a glutamine residue [(PUBMED:11731489)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PQ-loop