The domain within your query sequence starts at position 134 and ends at position 247; the E-value for the PRAS domain shown below is 1.3e-39.
GLFMMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPTACPQPPATALPTQQYAKSLPV SVPVWAFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
PRAS |
![]() |
---|
PFAM accession number: | PF15798 |
---|---|
Interpro abstract (IPR026682): | Proline-rich AKT1 substrate 1 protein (AKT1S1, PRAS40) is part of the mammalian target of rapamycin complex 1 (mTORC1, contains MTOR, MLST8, RPTOR, AKT1S1/PRAS40 and DEPTOR), which regulates cell growth and survival in response to nutrient and hormonal signals [ (PUBMED:12150925) ]. Within mTORC1, AKT1S1 negatively regulates mTOR activity in a manner that is dependent on its phosphorylation state and binding to 14-3-3 proteins. AKT1S1 is a substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. It may also play a role in nerve growth factor-mediated neuroprotection [ (PUBMED:16397181) (PUBMED:14973226) ]. |
GO process: | negative regulation of TOR signaling (GO:0032007), neurotrophin TRK receptor signaling pathway (GO:0048011) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRAS