The domain within your query sequence starts at position 199 and ends at position 323; the E-value for the PRAS domain shown below is 1.2e-51.

GLFMMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPTACPQPPATALPTQQYAKSLPV
SVPVWAFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNT
SDFQK

PRAS

PRAS
PFAM accession number:PF15798
Interpro abstract (IPR026682): Proline-rich AKT1 substrate 1 protein (AKT1S1, PRAS40) is part of the mammalian target of rapamycin complex 1 (mTORC1, contains MTOR, MLST8, RPTOR, AKT1S1/PRAS40 and DEPTOR), which regulates cell growth and survival in response to nutrient and hormonal signals [(PUBMED:12150925)]. Within mTORC1, AKT1S1 negatively regulates mTOR activity in a manner that is dependent on its phosphorylation state and binding to 14-3-3 proteins. AKT1S1 is a substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. It may also play a role in nerve growth factor-mediated neuroprotection [(PUBMED:16397181), (PUBMED:14973226)].
GO process:neurotrophin TRK receptor signaling pathway (GO:0048011), negative regulation of TOR signaling (GO:0032007)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRAS