The domain within your query sequence starts at position 275 and ends at position 490; the E-value for the PRCC domain shown below is 7.2e-62.

NFFSLPDKAEPPGVEPYPYPVPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPW
MPKPGDDYSYNQFSTYGDANAAGAYYQDYYSGGYYPAPDPALVPPQEIAPDASFIDDEAF
KRLQGKRNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRK
HQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG

PRCC

PRCC
PFAM accession number:PF10253
Interpro abstract (IPR018800):

This family constitutes the major, conserved, portion of PRCC proteins. In humans,this family interacts with MAD2B, the mitotic checkpoint protein [(PUBMED:8986805), (PUBMED:11717438)]. In Schizosaccharomyces pombe this protein is part of the Cwf-complex that is known to be involved in pre-mRNA splicing [(PUBMED:11884590)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRCC