The domain within your query sequence starts at position 17 and ends at position 173; the E-value for the PRELI domain shown below is 5.3e-57.

ELIMAAYERRFPTCPLIPMFVDSDTVSEFKSEDGALHVIERRCKLDIDAPRLLKKIAGVD
YVYFVQKNSLNSRDRTLHIEAHNETFSNRVIIHEHCCYTVHPENEDWTCFEQSASLDIKS
FFGFESTVEKIAMKHYTSNIKKGKEIIEYYLRQLEEE

PRELI

PRELI
PFAM accession number:PF04707
Interpro abstract (IPR006797):

The PRELI/MSF1 domain is an eukaryotic protein module which occurs in stand- alone form in several proteins, including the human PRELI protein and the yeast MSF1 protein, and as an amino-terminal domain in an orthologous group of proteins typified by human SEC14L1, which is conserved in all animals. In this group of proteins, the PRELI/MSF1 domain co-occurs with the CRAL-TRIO and the GOLD domains. The PRELI/MSF1 domain is approximately 170 residues long and is predicted to assume a globular alpha + beta fold with six beta strands and four alpha helices. It has been suggested that the PRELI/MSF1 domain may have a function associated with cellular membrane [(PUBMED:12049664)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRELI