The domain within your query sequence starts at position 31 and ends at position 204; the E-value for the PRF domain shown below is 1.4e-23.
IGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMED AERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTAL GLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA
PRF |
---|
PFAM accession number: | PF06875 |
---|---|
Interpro abstract (IPR010681): | This family includes plethodontid receptivity factor (PRF) proteins which seem to be specific to Plethodon jordani (Jordan's salamander). PRF is a courtship pheromone produced by males increase female receptivity [ (PUBMED:10489368) ]. This family also includes cardiotrophin-2 (neuropoietin) and cardiotrophin-like cytokine factor 1 (CLCF1) from mammals, which share sequence similarity to PRF [ (PUBMED:15014164) ]. They are four-helix bundle cytokines that signal through the gp130 receptor subunit [ (PUBMED:26198769) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRF