SMART: Pfam domain PRF

The domain within your query sequence starts at position 31 and ends at position 204; the E-value for the PRF domain shown below is 1.4e-23.

IGQAYSLALYMQKNTSALLQTYLQHQGSPFSDPGFSAPELQLSTLPSAAVSFKTWHAMED
AERLSRAQGAFLALTQHLQLVGDDQSYLNPGSPILLAQLGAARLRAQGLLGNMAAIMTAL
GLPIPPEEDTLGFVPFGASAFERKCRGYIVTREYGHWTDRAVRDLALLKAKYSA

PRF

PFAM accession number:	PF06875
Interpro abstract (IPR010681):	This family includes plethodontid receptivity factor (PRF) proteins which seem to be specific to Plethodon jordani (Jordan's salamander). PRF is a courtship pheromone produced by males increase female receptivity [ (PUBMED:10489368) ]. This family also includes cardiotrophin-2 (neuropoietin) and cardiotrophin-like cytokine factor 1 (CLCF1) from mammals, which share sequence similarity to PRF [ (PUBMED:15014164) ]. They are four-helix bundle cytokines that signal through the gp130 receptor subunit [ (PUBMED:26198769) ].

PFAM accession number:

PF06875

Interpro abstract (IPR010681):

This family includes plethodontid receptivity factor (PRF) proteins which seem to be specific to Plethodon jordani (Jordan's salamander). PRF is a courtship pheromone produced by males increase female receptivity [ (PUBMED:10489368) ].

This family also includes cardiotrophin-2 (neuropoietin) and cardiotrophin-like cytokine factor 1 (CLCF1) from mammals, which share sequence similarity to PRF [ (PUBMED:15014164) ]. They are four-helix bundle cytokines that signal through the gp130 receptor subunit [ (PUBMED:26198769) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRF