The domain within your query sequence starts at position 108 and ends at position 181; the E-value for the PRKCSH domain shown below is 8.6e-19.

APCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGDVLYLGHYQSSFNWDDETAKASKQHRL
KRYHSQTYGNGSKC

PRKCSH

PRKCSH
PFAM accession number:PF07915
Interpro abstract (IPR012913):

This entry represents a domain found in the OS9 protein, which is a lectin that functions in endoplasmic reticulum (ER) quality control and ER-associated degradation (ERAD) [ (PUBMED:17932042) ].

The sequences of this domainare similar to a region found in the beta-subunit of glucosidase II ( P14314 ), which is also known as protein kinase C substrate 80K-H (PRKCSH).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRKCSH