SMART: Pfam domain PRKCSH

The domain within your query sequence starts at position 366 and ends at position 512; the E-value for the PRKCSH_1 domain shown below is 4.3e-23.

ARSKFEEVERSLKEMEESIRSLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYRLCPFKL
VSQKPKHGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETVVT
STTEPSRCEYLMELMTPAACPEPPPEA

PRKCSH_1

PFAM accession number:	PF13015
Interpro abstract (IPR036607):	The sequences found in this entry are similar to a region found in the beta-subunit of glucosidase II ( P14314 ), which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyses the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing [ (PUBMED:10929008) ]. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum [ (PUBMED:10929008) ]. The beta-subunit confers substrate specificity for di- and monoglucosylated glycans on the glucose-trimming activity of the alpha-subunit [ (PUBMED:19395677) ].

PFAM accession number:

PF13015

Interpro abstract (IPR036607):

The sequences found in this entry are similar to a region found in the beta-subunit of glucosidase II ( P14314 ), which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyses the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing [ (PUBMED:10929008) ]. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum [ (PUBMED:10929008) ]. The beta-subunit confers substrate specificity for di- and monoglucosylated glycans on the glucose-trimming activity of the alpha-subunit [ (PUBMED:19395677) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRKCSH_1