The domain within your query sequence starts at position 373 and ends at position 519; the E-value for the PRKCSH_1 domain shown below is 4.4e-23.

ARSKFEEVERSLKEMEESIRSLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYRLCPFKL
VSQKPKHGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETVVT
STTEPSRCEYLMELMTPAACPEPPPEA

PRKCSH_1

PRKCSH_1
PFAM accession number:PF13015
Interpro abstract (IPR036607):

The sequences found in this entry are similar to a region found in the beta-subunit of glucosidase II (P14314), which is also known as protein kinase C substrate 80K-H (PRKCSH). The enzyme catalyses the sequential removal of two alpha-1,3-linked glucose residues in the second step of N-linked oligosaccharide processing [(PUBMED:10929008)]. The beta subunit is required for the solubility and stability of the heterodimeric enzyme, and is involved in retaining the enzyme within the endoplasmic reticulum [(PUBMED:10929008)]. The beta-subunit confers substrate specificity for di- and monoglucosylated glycans on the glucose-trimming activity of the alpha-subunit [(PUBMED:19395677)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRKCSH_1