The domain within your query sequence starts at position 930 and ends at position 993; the E-value for the PRKG1_interact domain shown below is 4.5e-11.

DFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSQLEMEKRVAGKS
QYLL

PRKG1_interact

PRKG1_interact
PFAM accession number:PF15898
Interpro abstract (IPR031775):

This domain is found at the C terminus of protein phosphatase 1 regulatory subunits 12A (PPP1R12A), 12B and 12C. In PPP1R12A it has been found to bind to cGMP-dependent protein kinase 1 via a leucine zipper motif located at the C terminus of this domain [(PUBMED:12873707), (PUBMED:10567269)].

GO function:protein kinase binding (GO:0019901)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRKG1_interact