The domain within your query sequence starts at position 338 and ends at position 746; the E-value for the PROCN domain shown below is 1.7e-226.

LYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLK
YYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKN
LNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAF
QLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAA
GWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHD
ILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTN
TAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYI

PROCN

PROCN
PFAM accession number:PF08083
Interpro abstract (IPR012592):

The PROCN domain is the central domain in pre-mRNA splicing factors of PRO8 family [(PUBMED:15112237)].

GO process:mRNA splicing, via spliceosome (GO:0000398)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PROCN