The domain within your query sequence starts at position 339 and ends at position 575; the E-value for the PRORP domain shown below is 4.8e-106.

IQKSGQCSGCGRTIEPIHLSPEEYEFLKEKIMRDVIDGGDQYKKTTPQELKRFESFVNSC
PPFDIVIDGLNVAKMFPKGRESQNLLGVVSQLAQQNLQLLVLGRKHMLRPSSQWRKEEME
QVRKQAHCFFADNISEDDPFLLYATLNSGNHCKFITKDLLRDHKACLPDARTQRLFFKWQ
QGHQLAIMKGFQKSKLTFQHILSYDTVVQRTGDSWHIPYDEDLVQRSSCEVPTKWLC

PRORP

PRORP
PFAM accession number:PF16953
Interpro abstract (IPR031595):

This entry represents a domain found in protein-only RNase P (PRORP), an enzyme that processes precursor tRNAs in human mitochondria and in all tRNA-using compartments of Arabidopsis thaliana. PRORP catalyses the maturation of the 5' ends of tRNA precursors [(PUBMED:22991464)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRORP