The domain within your query sequence starts at position 227 and ends at position 469; the E-value for the PRP21_like_P domain shown below is 7e-81.

SKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVD
FQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDQEKAEETPSQLDQ
DTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPD
EYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQ
LAE

PRP21_like_P

PRP21_like_P
PFAM accession number:PF12230
Interpro abstract (IPR022030):

This domain is found in eukaryotes, and is typically between 212 and 238 amino acids in length. It is found in association with. There are two completely conserved residues (W and H) that may be functionally important. It is found in the subunit 1 of mammalian splicing factor SF3A, which is involved in converting the U2 snRNP into its active form during pre-mRNA splicing [(PUBMED:7489498)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRP21_like_P