The domain within your query sequence starts at position 179 and ends at position 262; the E-value for the PRP38_assoc domain shown below is 4e-12.
PRVSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPALRYRRSRSRS PRRRSRSPKRRSPSPRRERHRSKS
PRP38_assoc |
 |
|---|
| PFAM accession number: | PF12871 |
|---|---|
| Interpro abstract (IPR024767): | This entry represents a hydrophilic domain found mainly at the C terminus of plant and animal pre-mRNA-splicing factor 38 proteins. The function of the domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRP38_assoc