The domain within your query sequence starts at position 723 and ends at position 857; the E-value for the PRT_C domain shown below is 2.4e-11.

RPMKGKASSTQDSQESTDVEEEGKEEEKESEKKGIIERIYMVQDIVSTVQNILEEVASFG
ERIKNVFNWTVPFLSLLACLILAITTVILYFIPLRYIILLWGINKFTKKLRNPYSIDNNE
LLDFLSRVPSDIQKV

PRT_C

PRT_C
PFAM accession number:PF08372
Interpro abstract (IPR013583):

This domain is found at the C terminus of phosphoribosyltransferases and phosphoribosyltransferase-like proteins. It contains putative transmembrane regions. It often appears together with calcium-ion dependent C2 domains (IPR000008).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRT_C