The domain within your query sequence starts at position 853 and ends at position 1169; the E-value for the PS-DH domain shown below is 9.9e-24.

GSSSSSATVYSIDASPESPDHYLVDHCIDGRVIFPGTGYLCLVWKTLARSLGLSLEETPV
VFENVSFHQATILPKTGTVALEVRLLEASHAFEVSDTGNLIVSGKVYLWEDPNSKLFDHP
EVPTPPESASVSRLTQGEVYKELRLRGYDYGPQFQGICEATLEGEQGKLLWKDNWVTFMD
TMLQVSILGSSQQSLQLPTRVTAIYIDPATHRQKVYRLKEDTQVADVTTSRCLGITVSGG
IHISRLQTTATSRRQQEQLVPTLEKFVFTPHMEAECLSESTALQKELQLCKGLARALQTK
ATQQGLKAAMLGQEDPP

PS-DH

PS-DH
PFAM accession number:PF14765
Interpro abstract (IPR020807): This entry represents the dehydratase domain found in polyketide synthases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PS-DH