The domain within your query sequence starts at position 21 and ends at position 113; the E-value for the PSP94 domain shown below is 6.4e-46.

VCSIENREIFPNQMSDDCMDADGNKHFLNTPWKKNCTWCSCDKTSITCCTNATRPLSYDK
DNCDVQFHPENCTYSVVDRKNPGKTCRVDSWTM

PSP94

PSP94
PFAM accession number:PF05825
Interpro abstract (IPR008735):

This family consists of the protein beta-microseminoprotein/prostate-associated microseminoprotein from humans and some small serum protein from snakes. Prostatic secretory protein of 94 amino acids (PSP94), also called beta-microseminoprotein, is a small, nonglycosylated protein, rich in cysteine residues. It was first isolated as a major protein from Homo sapiens seminal plasma [ (PUBMED:10639193) ]. The exact function of this protein is unknown.

The small serum proteins may serve as a self-defense protein against the toxic effects of the snake venom during accidental envenomation.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PSP94