The domain within your query sequence starts at position 60 and ends at position 191; the E-value for the PSS domain shown below is 7.3e-60.

PHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPRLGVPLPERDYGGNCLIYDA
DNKTDPFHNIWDKLDGFVPAHFIGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFS
ECWWDHWIMDV

PSS

PSS
PFAM accession number:PF03034
Interpro abstract (IPR004277): Phosphatidyl serine synthase is also known as serine exchange enzyme (EC 2.7.8). This family represents eukaryotic PSS I and II, membrane bound proteins that catalyse the replacement of the head group of a phospholipid (phosphotidylcholine or phosphotidylethanolamine) by L-serine.
GO process:phosphatidylserine biosynthetic process (GO:0006659)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PSS