The domain within your query sequence starts at position 20 and ends at position 173; the E-value for the PTCRA domain shown below is 1.4e-91.
RCQALPSGIAGTPFPSLAPPITLLVDGRQHMLVVCLVLDAAPPGLDNPVWFSAGNGSALD AFTYGPSLAPDGTWTSLAQLSLPSEELEAWEPLVCHTRPGAGGQNRSTHPLQLSGESSTA RSCFPEPLGGTQRQVLWLSLLRLLLFKLLLLDVL
PTCRA |
---|
PFAM accession number: | PF15028 |
---|---|
Interpro abstract (IPR027834): | The pre-T-cell antigen receptor (pre-TCR), expressed by immature thymocytes, has a pivotal role in early T-cell development, including TCR beta-selection, survival and proliferation of CD4(-)CD8(-) double-negative thymocytes, and subsequent alpha/beta T-cell lineage differentiation [ (PUBMED:20944746) ]. This protein contains an immunoglobulin domain [ (PUBMED:20944746) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTCRA