The domain within your query sequence starts at position 25 and ends at position 139; the E-value for the PTH2 domain shown below is 2.4e-26.

LVQYLVLRKDLSQAPFSWPTGALVAQACHAATAALHLHRDHPHTAAYLRELGRMRKVVLE
AADETTLKELAETLQQKNIDHTLWLEQPENIATCIALRPYPKEEVSQYLKKFRLF

PTH2

PTH2
PFAM accession number:PF01981
Interpro abstract (IPR002833):

Peptidyl-tRNA hydrolases are enzymes that release tRNAs from peptidyl-tRNA during translation [(PUBMED:12475929)].

GO function:aminoacyl-tRNA hydrolase activity (GO:0004045)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTH2