The domain within your query sequence starts at position 50 and ends at position 322; the E-value for the PTRF_SDPR domain shown below is 3.7e-102.

QVNGVLVLSLLDKIIGAVDQIQLTQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTV
SKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLS
VSKSLKESEALPEKEGDELGEGERPEDDTAAIELSSDEAVEVEEVIEESRAERIKRSGLR
RVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLVPVERR
EKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPP

PTRF_SDPR

PTRF_SDPR
PFAM accession number:PF15237
Interpro abstract (IPR026752):

This entry represents the cavin family (caveolae-associated proteins; previously known as the PTRF/SDPR family), which includes proteins cavin-1 to 4. They are critical regulators for caveolae dynamics [(PUBMED:20363285)]. Caveolae are invaginations of the plasma membrane involved in many cellular processes, including clathrin-independent endocytosis, cholesterol transport, and signal transduction. Caveolins are the principal components of caveolae membranes. Polymerase I and transcript release factor (PTRF; also known as cavin-1) is essential for formation of caveolae and proper localisation of caveolins [(PUBMED:19726876)].

Cavin-2 (also known as serum deprivation-response protein) may play a role in targeting protein kinase C alpha (PKCalpha) to caveolae [(PUBMED:9566962)]. Cavin-3 (protein kinase C delta-binding protein, also known as SRBC) seems to have an immune potentiation function, especially in the glioma [(PUBMED:9054438), (PUBMED:15197346)]. Cavin-4 (muscle-related coiled-coil protein) is a muscle-restricted cavin [(PUBMED:18332105)].

The members of the cavin family contain putative leucine zipper-like domains normally involved in protein-protein interactions and PEST domains (proline, glutamic acid, serine and threonine-rich domains), which may play a role in targeting proteins towards proteolytic degradation [(PUBMED:15242332)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTRF_SDPR