The domain within your query sequence starts at position 66 and ends at position 151; the E-value for the PUB domain shown below is 6.8e-17.

NYLNTLSTALNILEKYGRNLLSPQRPRYWRSVKFNNPVFRSTVDAVQGGRDVLRLYGYTE
ERPDGLSFPEGQEEPDEYQVAVVTLE

PUB

PUB
PFAM accession number:PF09409
Interpro abstract (IPR018997):

The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain [(PUBMED:16807242)]. This domain is also found on other proteins linked to the ubiquitin-proteasome system.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUB