The domain within your query sequence starts at position 66 and ends at position 151; the E-value for the PUB domain shown below is 6.8e-17.
NYLNTLSTALNILEKYGRNLLSPQRPRYWRSVKFNNPVFRSTVDAVQGGRDVLRLYGYTE ERPDGLSFPEGQEEPDEYQVAVVTLE
PUB |
---|
PFAM accession number: | PF09409 |
---|---|
Interpro abstract (IPR018997): | The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain [ (PUBMED:16807242) ]. This domain is also found on other proteins linked to the ubiquitin-proteasome system. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUB