The domain within your query sequence starts at position 1638 and ends at position 1751; the E-value for the PUFD domain shown below is 5.6e-54.

SDLFEFEFAESSLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIFRSNFPNLEIVTIA
EAEFYRQVSTSLLFSCPKDLEAFNPESKELLDLVEFTNELQTLLGSSVEWLHPS

PUFD

PUFD
PFAM accession number:PF16553
Interpro abstract (IPR032365):

This entry represents the minimal domain at the C terminus of BCOR (BCL6 corepressor) that is needed for binding specifically to some of the PCGF proteins (polycomb-group RING finger homologues). Because of the selective binding, this domain has been named PCGF Ub-like fold discriminator (PUFD). PUFD binds to the RAWUL (RING finger- and WD40-associated ubiquitin-like) domain of the particular PCGF, PCGF1. Polycomb group proteins form repressive complexes (PRC) that mediate epigenetic modifications of histones. In humans there are many different PCGF homologues whose functions all vary, but the direct binding partner of PCGF1 is BCOR. BCOR has emerged as an important player in development and health [(PUBMED:23523425)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUFD