The domain within your query sequence starts at position 2 and ends at position 193; the E-value for the PUMA domain shown below is 8.5e-97.

ARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCA
PTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQ
AAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPL
PRDPGAPEMEPN

PUMA

 PUMA
PFAM accession number:PF15826
Interpro abstract (IPR031661):

PUMA (p53 upregulated modulator of apoptosis), also known as Bbc3 (Bcl-2-binding component 3), is a critical mediator of p53-dependent and -independent apoptosis [ (PUBMED:19641508) ]. PUMA transduces death signals primarily to the mitochondria. It is induced in cells after p53 activation. It binds to Bcl-2, localises to the mitochondria to induce cytochrome c release, and activates the rapid induction of apoptosis [ (PUBMED:11463392) ]. PUMA is capable of inhibiting all the five major anti-apoptotic Bcl-2-like proteins (Mcl-1, Bcl-2, Bcl-XL, Bcl-W and A1) [ (PUBMED:19641508) ]. The binding of PUMA to the inhibitory members of the Bcl-2 family via its BH3 domain results in the displacement of the proteins Bax and/or Bak, and seems to be a critical regulatory step in the induction of apoptosis [ (PUBMED:23001513) ].

GO process:positive regulation of apoptotic process (GO:0043065), positive regulation of release of cytochrome c from mitochondria (GO:0090200), intrinsic apoptotic signaling pathway (GO:0097193)
GO component:mitochondrion (GO:0005739)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUMA