The domain within your query sequence starts at position 381 and ends at position 458; the E-value for the PWWP domain shown below is 2.9e-8.

FEVGMLVWLKYQKYPFWPAVVKSVRRRDKKASVLFIEGNMNPKGRGITVSLRRLKHFDCK
EKHALLDRAKEDFAQAIG

PWWP

PWWP
PFAM accession number:PF00855
Interpro abstract (IPR000313):

The PWWP domain is an around 70 amino acids domain that was named after its central core 'Pro-Trp-Trp-Pro'. The PWWP domain is found in one or, less frequently, in two copies in nuclear, often DNA-binding proteins that function as transcription factors regulating developmental processes. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present, it has been proposed that the PWWP domain is involved in protein-protein interactions [(PUBMED:10802047)].

Conservation of the PWWP domain is concentrated on one major and two minor blocks with length differences occurring in between [(PUBMED:10802047)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PWWP