The domain within your query sequence starts at position 157 and ends at position 330; the E-value for the PXA domain shown below is 8.2e-49.

SSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLVRRIHKVDIPSI
ITKKLLKAAMKHIEVIVKARQKVKNTEYLQQAALEEYGPELHVALRSRRDELQYLRKLTE
LLFPYILPPKATDCRSLTLLIREILSGSVLLPSLDFLADPDTVNHLLIIFIDDS

PXA

PXA
PFAM accession number:PF02194
Interpro abstract (IPR003114): This domain is found associated with PX domains. The PX (phox) domain [(PUBMED:8931154)] occurs in a variety of eukaryotic proteins associated with intracellular signalling pathways.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PXA