The domain within your query sequence starts at position 1 and ends at position 51; the E-value for the PXT1 domain shown below is 2.8e-34.

MQLRHIGDSVNHRVIQEHLAQEVGDVLAPFVALVFVRGQVLLRFFWNNHLL

PXT1

• PFAM accession number: PF15214
• Interpro abstract (IPR029186):

  This family of proteins is testis-specific [ (PUBMED:18160785) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PXT1