The domain within your query sequence starts at position 862 and ends at position 1062; the E-value for the PYC_OADA domain shown below is 1.4e-72.

VYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQF
MVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGA
SLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQ
GPKIAEEFEVELERGKTLHIK

PYC_OADA

PYC_OADA
PFAM accession number:PF02436
Interpro abstract (IPR003379): This domain represents a conserved region in pyruvate carboxylase (PYC) (EC 6.4.1.1), oxaloacetate decarboxylase alpha chain (OADA) (EC 4.1.1.3), and transcarboxylase 5s subunit (EC 2.1.3.1). The domain is found adjacent to the HMGL-like domain (IPR000891) and often close to the biotin_lipoyl domain (IPR000089) of biotin requiring enzymes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PYC_OADA