The domain within your query sequence starts at position 190 and ends at position 342; the E-value for the PaaSYMP domain shown below is 1.4e-65.

TQTDYRDADVQTDPYSPEYVVCQDTIPELLTLANLTWGRGLPAGQAEVEIIERAREKRAW
EATLPPLNDSVQAEKRRKMMNAMERKEWAFREGEIEKLQELRLEVLKQLLKRREEDQNEL
NMRHLNDQWYKLQEAKEAKVAQIRHKHVSDIRK

PaaSYMP

PaaSYMP
PFAM accession number:PF14738
Interpro abstract (IPR032840): This entry represents a domain found in the CFAP91 protein. CFAP91 (also known as AMY-1-associating protein expressed in testis 1 or AAT-1) is a component of a spoke-associated complex, regulates flagellar dynein activity by mediating regulatory signals between the radial spokes and dynein arms [(PUBMED:17967944)]. It binds to AMY1 and may play a role in spermatogenesis [(PUBMED:12223483)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PaaSYMP