The domain within your query sequence starts at position 546 and ends at position 958; the E-value for the Pacs-1 domain shown below is 2e-193.

VYDQLNQILVSDAALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQAVLSALL
TRIQRYCNCNSSMPRPVKVAAVGSQSYLSSILRFFVKSLASKTPDWLGYMRFLIIPLGSH
PVAKYLGSVDSRYSSTFLDSAWRDLFSRSEPPVSEPLDVVGRVMQYVNGATTTHQLPVAE
AMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDSPVVSLTVPSTSPPSSSG
LSRDATATPPSSPSMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRDASSKN
TLKSVFRSVQVSRLPHAGEAQLSGTMAMTVVTKEKNKKVPTIFLSKKPREKEVDSKSQVI
EGISRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGS

Pacs-1

Pacs-1
PFAM accession number:PF10254
Interpro abstract (IPR019381):

PACS-1 is a cytosolic sorting protein that directs the localisation of membrane proteins in the trans-Golgi network (TGN)/endosomal system. PACS-1 connects the clathrin adaptor AP-1 to acidic cluster sorting motifs contained in the cytoplasmic domain of cargo proteins such as furin, the cation-independent mannose-6-phosphate receptor and in viral proteins such as human immunodeficiency virus type 1 Nef [(PUBMED:9695949)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pacs-1