The domain within your query sequence starts at position 28 and ends at position 441; the E-value for the Paf1 domain shown below is 2.3e-154.
GVVCRVKYCNSLPDIPFDPKFITYPFDQNRFVQYKATSLEKQHKHDLLTEPDLGVTIDLI NPDTYRIDPNVLLDPADEKLLEEEIQAPTSSKRSQQHAKVVPWMRKTEYISTEFNRYGIS NEKPEVKIGVSVKQQFTEEEIYKDRDSQITAIEKTFEDAQKSISQHYSKPRVTPVEVMPV FPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEET LKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELE TRVRLSKRRAKAGVQSGTNALLVVKHRDMNEKELEAQEARKAQLENHEPEEEEEEEMEAE EKEAGGSDEEQEKGSSSEKEGSEDEHSGSESDREEGDRDEASDKSGSGEDESSE
Paf1 |
---|
PFAM accession number: | PF03985 |
---|---|
Interpro abstract (IPR007133): | In budding yeasts, Paf1 is part of the Paf1 complex, an RNA polymerase II-associated protein complex containing Paf1, Cdc73, Ctr9, Rtf1 and Leo1 [ (PUBMED:11884586) ]. Paf1 complex is involved in histone modifications, transcription elongation and other gene expression processes that include transcript site selection [ (PUBMED:20178742) ]. This entry also includes Paf1 homologues from animals and plants. Human Paf1, also known as PD2 (pancreatic differentiation 2), is associated with tumorigenesis [ (PUBMED:16491129) ]. Human Paf1 complex (Paf1C) consists of Paf1, Cdc73, Ctr9, Rtf1, Leo1 and Wdr61 (Ski8). As in yeast, the human Paf1C has a central role in co-transcriptional histone modifications [ (PUBMED:1913663) ]. Human Paf1 complex has a crucial role in the antiviral response [ (PUBMED:22419161) ]. Arabidopsis Paf1C related proteins such as VIP4 (Leo1), VIP5 (Rtf1), ELF7 (Paf1), ELF8 (Ctr9) and ATXR7 (Set1) are required for the induction of seed dormancy. They control both germination and flowering time [ (PUBMED:21799800) ]. |
GO process: | histone modification (GO:0016570), transcription elongation from RNA polymerase II promoter (GO:0006368) |
GO component: | Cdc73/Paf1 complex (GO:0016593) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Paf1