The domain within your query sequence starts at position 152 and ends at position 550; the E-value for the Paf67 domain shown below is 7e-179.

QRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEGE
MDFLRSNPKVWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGY
FSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQD
AIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLR
EKYGDKMLRMQKGDPQVYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEV
QQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDG
EFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKF

Paf67

Paf67
PFAM accession number:PF10255
Interpro abstract (IPR019382): Eukaryotic translation initiation factor 3 subunit L is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome [(PUBMED:15703437), (PUBMED:8995409)].
GO component:cytoplasm (GO:0005737), eukaryotic translation initiation factor 3 complex (GO:0005852)
GO function:translation initiation factor activity (GO:0003743)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Paf67