The domain within your query sequence starts at position 37 and ends at position 119; the E-value for the Palm_thioest domain shown below is 2.4e-10.

HPVIKIQVDVIVIVVSMKTSNETPKSGTYGQALQDGKNKMKDVENKVLDACSQLCQSLAQ
DPKLQHGYIVVAYFKEHQLLCCS

Palm_thioest

Palm_thioest
PFAM accession number:PF02089
Interpro abstract (IPR002472):

This entry represents the palmitoyl protein thioesterase family. Its members include palmitoyl-protein thioesterase 1 and lysosomal thioesterase 2 (PPT1 and PPT2). PPT1 is responsible for the removal of a palmitate group from its substrate proteins, which may include presynaptic proteins like SNAP-25, cysteine string protein (CSP), dynamin, and synaptotagmin [(PUBMED:24091420)]. PPT2 removes thioester-linked fatty acyl groups from various substrates including S-palmitoyl-CoA [(PUBMED:12855696)]. PPT1 and -2 perform non-redundant roles in lysosomal thioester catabolism [(PUBMED:12855696)].

Mutations in the PPT1 gene cause infantile-onset neuronal ceroid lipofuscinosis (INCL), which is a severe pediatric neurodegenerative disorder [(PUBMED:23747979)].

This entry also includes uncharacterised proteins from fungi and plants.

GO function:palmitoyl hydrolase activity (GO:0098599)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Palm_thioest